-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human PIM2 (NP_006866.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human PIM2 (NP_006866.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04945A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIM2 |
| Target Synonyms | PIM2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PIM2 (NP_006866.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGT | Uniprot ID | Q9P1W9 |
Uniprot Id
Q9P1W9
Target Species
Human
Target Name
PIM2
Target Full Name
Serine/threonine-protein kinase pim-2
Target Function
Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, PIM subfamily
Target Tissue Specificity
Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tissues.
Target Research Area
Cancer
Target Synonyms
OTTHUMP00000025825; Pim 2 oncogene; Pim 2h; Pim-2h; PIM2; PIM2 Oncogene; PIM2_HUMAN; Pim2h; Proto Oncogene PIM2; Proto-oncogene Pim-2 (serine threonine kinase); Serine/threonine kinase PIM2; Serine/threonine-protein kinase Pim-2
Target Background
This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.
Notification