-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PINK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PINK1 (NP_115785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
The antibody against PINK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PINK1 (NP_115785.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
| Cat.No | ADA-11602A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PINK1 |
| Target Synonyms | BRPK; PARK6; PINK1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, 293T, NTERA-2 | Application | WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PINK1 (NP_115785.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP | Uniprot ID | Q9BXM7 |
Uniprot Id
Q9BXM7
Target Species
Human
Target Name
PINK1
Target Full Name
Serine/threonine-protein kinase PINK1, mitochondrial
Target Function
Serine/threonine-protein kinase which protects against mitochondrial dysfunction during cellular stress by phosphorylating mitochondrial proteins such as PRKN and DNM1L, to coordinate mitochondrial quality control mechanisms that remove and replace dysfunctional mitochondrial components. Depending on the severity of mitochondrial damage and/or dysfunction, activity ranges from preventing apoptosis and stimulating mitochondrial biogenesis to regulating mitochondrial dynamics and eliminating severely damaged mitochondria via mitophagy. Mediates the translocation and activation of PRKN at the outer membrane (OMM) of dysfunctional/depolarized mitochondria. At the OMM of damaged mitochondria, phosphorylates pre-existing polyubiquitin chains at 'Ser-65', the PINK1-phosphorylated polyubiquitin then recruits PRKN from the cytosol to the OMM where PRKN is fully activated by phosphorylation at 'Ser-65' by PINK1. In damaged mitochondria, mediates the decision between mitophagy or preventing apoptosis by promoting PRKN-dependent poly- or monoubiquitination of VDAC1; polyubiquitination of VDAC1 by PRKN promotes mitophagy, while monoubiquitination of VDAC1 by PRKN decreases mitochondrial calcium influx which ultimately inhibits apoptosis. When cellular stress results in irreversible mitochondrial damage, functions with PRKN to promote clearance of damaged mitochondria via selective autophagy (mitophagy). The PINK1-PRKN pathway also promotes fission of damaged mitochondria by phosphorylating and thus promoting the PRKN-dependent degradation of mitochondrial proteins involved in fission such as MFN2. This prevents the refusion of unhealthy mitochondria with the mitochondrial network or initiates mitochondrial fragmentation facilitating their later engulfment by autophagosomes. Also promotes mitochondrial fission independently of PRKN and ATG7-mediated mitophagy, via the phosphorylation and activation of DNM1L. Regulates motility of damaged mitochondria by promoting the ubiquitination and subsequent degradation of MIRO1 and MIRO2; in motor neurons, this likely inhibits mitochondrial intracellular anterograde transport along the axons which probably increases the chance of the mitochondria undergoing mitophagy in the soma. Required for ubiquinone reduction by mitochondrial complex I by mediating phosphorylation of complex I subunit NDUFA10.
Target Involvement
Parkinson disease 6 (PARK6)
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Mitochondrion inner membrane; Single-pass membrane protein. Cytoplasm, cytosol.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Tissue Specificity
Highly expressed in heart, skeletal muscle and testis, and at lower levels in brain, placenta, liver, kidney, pancreas, prostate, ovary and small intestine. Present in the embryonic testis from an early stage of development.
Target Synonyms
BRPK; FLJ27236; mitochondrial; PARK 6; PARK6; Phosphatase and Tensin Homolog; PINK 1; PINK1; PINK1_HUMAN; Protein kinase BRPK; PTEN induced putative kinase 1; PTEN induced putative kinase protein 1; PTEN-induced putative kinase protein 1; Serine/threonine kinase PINK1 mitochondrial; Serine/threonine protein kinase PINK1 mitochondrial; Serine/threonine-protein kinase PINK1
Target Background
This gene encodes a serine/threonine protein kinase that localizes to mitochondria. It is thought to protect cells from stress-induced mitochondrial dysfunction. Mutations in this gene cause one form of autosomal recessive early-onset Parkinson disease.
Notification