Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human PMP2 (NP_002668.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human PMP2 (NP_002668.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01093A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PMP2 |
| Target Synonyms | P2; MP2; CMT1G; FABP8; M-FABP; PMP2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse small intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human PMP2 (NP_002668.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV | Uniprot ID | P02689 |
Uniprot Id
P02689
Target Species
Human
Target Name
PMP2
Target Full Name
Myelin P2 protein
Target Function
May play a role in lipid transport protein in Schwann cells. May bind cholesterol.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Research Area
Transport
Target Synonyms
FABP8; M FABP; MP2; Myelin FABP ; Myelin P2 protein; MYP2_HUMAN; P2; Peripheral myelin protein 2; PMP2
Target Background
The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
