-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PNLIPRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-470 of human PNLIPRP2 (NP_005387.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PNLIPRP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 301-470 of human PNLIPRP2 (NP_005387.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03318A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PNLIPRP2 |
| Target Synonyms | PLRP2; PNLIPRP2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat pancreas | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 301-470 of human PNLIPRP2 (NP_005387.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC | Uniprot ID | P54317 |
Uniprot Id
P54317
Target Species
Human
Target Name
PNLIPRP2
Target Full Name
Pancreatic lipase-related protein 2
Target Function
Lipase that primarily hydrolyzes triglycerides and galactosylglycerides. In neonates, may play a major role in pancreatic digestion of dietary fats such as milk fat globules enriched in long-chain triglycerides. Hydrolyzes short-, medium- and long-chain fatty acyls in triglycerides without apparent positional specificity. Can completely deacylate triacylglycerols. When the liver matures and bile salt synthesis increases, likely functions mainly as a galactolipase and monoacylglycerol lipase. Hydrolyzes monogalactosyldiglycerols (MGDG) and digalactosyldiacylglycerols (DGDG) present in a plant-based diet, releasing long-chain polyunsaturated fatty acids. Hydrolyzes medium- and long-chain fatty acyls in galactolipids. May act together with LIPF to hydrolyze partially digested triglycerides. Hydrolyzes long-chain monoglycerides with high efficiency. In cytotoxic T cells, contributes to perforin-dependent cell lysis, but is unlikely to mediate direct cytotoxicity. Also has low phospholipase activity. In neurons, required for the localization of the phospholipid 1-oleoyl-2-palmitoyl-PC (OPPC) to neurite tips through acyl chain remodeling of membrane phospholipids. The resulting OPPC-rich lipid membrane domain recruits the t-SNARE protein STX4 by selectively interacting with the STX4 transmembrane domain and this promotes surface expression of the dopamine transporter SLC6A3/DAT at neurite tips by facilitating fusion of SLC6A3-containing transport vesicles with the plasma membrane.
Target Subcellular Location
Secreted. Zymogen granule membrane; Peripheral membrane protein. Cell projection, neuron projection.
Target Protein Families
AB hydrolase superfamily, Lipase family
Target Tissue Specificity
Pancreas.
Target Synonyms
EC 3.1.1.3; Galactolipase; LIPR2_HUMAN; Pancreatic lipase-related protein 2; PL-RP2; PLRP2; Pnliprp2; Secretory glycoprotein GP 3
Target Background
This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele.
Notification