-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POFUT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-194 of human POFUT1 (NP_758436.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POFUT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-194 of human POFUT1 (NP_758436.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10689A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POFUT1 |
| Target Synonyms | DDD2; FUT12; O-FUT; OFUCT1; O-Fuc-T; O-FucT-1; POFUT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, HL-60, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-194 of human POFUT1 (NP_758436.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR | Uniprot ID | Q9H488 |
Uniprot Id
Q9H488
Target Species
Human
Target Name
POFUT1
Target Full Name
GDP-fucose protein O-fucosyltransferase 1
Target Function
Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue found in the consensus sequence C2-X(4,5)-[S/T]-C3 of EGF domains, where C2 and C3 are the second and third conserved cysteines. Specifically uses GDP-fucose as donor substrate and proper disulfide pairing of the substrate EGF domains is required for fucose transfer. Plays a crucial role in NOTCH signaling. Initial fucosylation of NOTCH by POFUT1 generates a substrate for FRINGE/RFNG, an acetylglucosaminyltransferase that can then extend the fucosylation on the NOTCH EGF repeats. This extended fucosylation is required for optimal ligand binding and canonical NOTCH signaling induced by DLL1 or JAGGED1. Fucosylates AGRN and determines its ability to cluster acetylcholine receptors (AChRs).
Target Involvement
Dowling-Degos disease 2 (DDD2)
Target Subcellular Location
Endoplasmic reticulum.
Target Protein Families
Glycosyltransferase 65 family
Target Tissue Specificity
Highly expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
FUT 12; FUT12; GDP fucose protein O fucosyltransferase 1; GDP-fucose protein O-fucosyltransferase 1; O Fuc T; o fucosyltransferase protein; O FucT 1; O FucT; O FucT1; O FUT; O-FucT-1; OFUT 1; OFUT; OFUT1; OFUT1_HUMAN; Peptide O fucosyltransferase1; Peptide-O-fucosyltransferase 1; Pofut 1; POFUT1; Protein O fucosyltransferase1
Target Background
This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Notification