-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human POLD4 (NP_066996.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human POLD4 (NP_066996.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01239A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLD4 |
| Target Synonyms | p12; POLDS; POLD4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human POLD4 (NP_066996.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL | Uniprot ID | Q9HCU8 |
Uniprot Id
Q9HCU8
Target Species
Human
Target Name
POLD4
Target Full Name
DNA polymerase delta subunit 4
Target Function
As a component of the tetrameric DNA polymerase delta complex (Pol-delta4), plays a role in high fidelity genome replication and repair. Within this complex, increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity. Pol-delta4 participates in Okazaki fragment processing, through both the short flap pathway, as well as a nick translation system. Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR), a mechanism that may induce segmental genomic duplications of up to 200 kb. Involved in Pol-delta4 translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites. Its degradation in response to DNA damage is required for the inhibition of fork progression and cell survival
Target Subcellular Location
Nucleus.
Target Protein Families
DNA polymerase delta subunit 4 family
Target Synonyms
POLD4; POLDSDNA polymerase delta subunit 4; DNA polymerase delta subunit p12
Target Background
This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification