-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POLE3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POLE3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16917A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POLE3 |
| Target Synonyms | p17; YBL1; CHRAC2; CHRAC17; CHARAC17; E3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse bone marrow, Mouse spleen, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN | Uniprot ID | Q9NRF9 |
Uniprot Id
Q9NRF9
Target Species
Human
Target Name
POLE3
Target Full Name
DNA polymerase epsilon subunit 3
Target Function
Accessory component of the DNA polymerase epsilon complex. Participates in DNA repair and in chromosomal DNA replication. Forms a complex with CHRAC1 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome-remodeling activity of ISWI/SNF2H and ACF1. Does not enhance nucleosome sliding activity of the ACF-5 ISWI chromatin remodeling complex.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
Arsenic transactivated protein; Arsenic-transactivated protein; ASTP; CHARAC 17; CHARAC17; CHRAC 17 ; CHRAC-17; CHRAC17; Chromatin Accessibility Complex 17; Chromatin accessibility complex 17 kDa protein; DNA Polymerase Epsilon p17 Subunit; DNA polymerase epsilon subunit 3; DNA polymerase epsilon subunit p17; DNA polymerase II subunit 3; DPOE3_HUMAN; Histone fold protein CHRAC17; HuCHRAC 17; HuCHRAC17; p17; p17 subunit; POL E3; POLE 3; POLE3; Polymerase (DNA directed) epsilon 3; YBL 1; YBL1
Target Background
POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Notification