-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT4/CARM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PRMT4/CARM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13460A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT4/CARM1 |
| Target Synonyms | PRMT4; M1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT | Uniprot ID | Q86X55 |
Uniprot Id
Q86X55
Target Species
Human
Target Name
CARM1
Target Full Name
Histone-arginine methyltransferase CARM1
Target Function
Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, pre-mRNA splicing, and mRNA stability. Recruited to promoters upon gene activation together with histone acetyltransferases from EP300/P300 and p160 families, methylates histone H3 at 'Arg-17' (H3R17me), forming mainly asymmetric dimethylarginine (H3R17me2a), leading to activate transcription via chromatin remodeling. During nuclear hormone receptor activation and TCF7L2/TCF4 activation, acts synergically with EP300/P300 and either one of the p160 histone acetyltransferases NCOA1/SRC1, NCOA2/GRIP1 and NCOA3/ACTR or CTNNB1/beta-catenin to activate transcription. During myogenic transcriptional activation, acts together with NCOA3/ACTR as a coactivator for MEF2C. During monocyte inflammatory stimulation, acts together with EP300/P300 as a coactivator for NF-kappa-B. Acts as coactivator for PPARG, promotes adipocyte differentiation and the accumulation of brown fat tissue. Plays a role in the regulation of pre-mRNA alternative splicing by methylation of splicing factors. Also seems to be involved in p53/TP53 transcriptional activation. Methylates EP300/P300, both at 'Arg-2142', which may loosen its interaction with NCOA2/GRIP1, and at 'Arg-580' and 'Arg-604' in the KIX domain, which impairs its interaction with CREB and inhibits CREB-dependent transcriptional activation. Also methylates arginine residues in RNA-binding proteins PABPC1, ELAVL1 and ELAV4, which may affect their mRNA-stabilizing properties and the half-life of their target mRNAs.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Mainly nuclear during the G1, S and G2 phases of the cell cycle. Cytoplasmic during mitosis, after breakup of the nuclear membrane.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family
Target Tissue Specificity
Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia.
Target Synonyms
carm1; CARM1_HUMAN; Coactivator associated arginine methyltransferase 1; Coactivator-associated arginine methyltransferase 1; Histone arginine methyltransferase CARM 1; Histone arginine methyltransferase CARM1; Histone-arginine methyltransferase CARM1; PRMT 4; PRMT4; Protein arginine methyltransferase; Protein arginine N methyltransferase 4; Protein arginine N-methyltransferase 4
Target Background
This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.
Notification