-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT5 (O14744) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PRMT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT5 (O14744) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16529A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT5 |
| Target Synonyms | HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5; PRMT5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, A-431, Hep G2, Mouse brain, Mouse spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT5 (O14744). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIR | Uniprot ID | O14744 |
Uniprot Id
O14744
Target Species
Human
Target Name
PRMT5
Target Full Name
Protein arginine N-methyltransferase 5
Target Function
Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H and may regulate its transcriptional elongation properties. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10. Attenuates EGF signaling through the MAPK1/MAPK3 pathway acting at 2 levels. First, monomethylates EGFR; this enhances EGFR 'Tyr-1197' phosphorylation and PTPN6 recruitment, eventually leading to reduced SOS1 phosphorylation. Second, methylates RAF1 and probably BRAF, hence destabilizing these 2 signaling proteins and reducing their catalytic activity. Required for induction of E-selectin and VCAM-1, on the endothelial cells surface at sites of inflammation. Methylates HOXA9. Methylates and regulates SRGAP2 which is involved in cell migration and differentiation. Acts as a transcriptional corepressor in CRY1-mediated repression of the core circadian component PER1 by regulating the H4R3 dimethylation at the PER1 promoter. Methylates GM130/GOLGA2, regulating Golgi ribbon formation. Methylates H4R3 in genes involved in glioblastomagenesis in a CHTOP- and/or TET1-dependent manner. Symmetrically methylates POLR2A, a modification that allows the recruitment to POLR2A of proteins including SMN1/SMN2 and SETX. This is required for resolving RNA-DNA hybrids created by RNA polymerase II, that form R-loop in transcription terminal regions, an important step in proper transcription termination. Along with LYAR, binds the promoter of gamma-globin HBG1/HBG2 and represses its expression. Symmetrically methylates NCL. Methylates TP53; methylation might possibly affect TP53 target gene specificity. Involved in spliceosome maturation and mRNA splicing in prophase I spermatocytes through the catalysis of the symmetrical arginine dimethylation of SNRPB (small nuclear ribonucleoprotein-associated protein) and the interaction with tudor domain-containing protein TDRD6.
Target Subcellular Location
Cytoplasm. Nucleus. Chromosome. Golgi apparatus.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
72 kDa ICln binding protein; 72 kDa ICln-binding protein; ANM5_HUMAN; Histone synthetic lethal 7; S. cerevisiae; homolog of; Histone-arginine N-methyltransferase PRMT5; HMT1 hnRNP methyltransferase like 5; HOMOLOG OF; SKB1; HRMT1L5; IBP72; Jak-binding protein 1; JBP 1; JBP1; PRMT 5; PRMT5; Protein arginine methyltransferase 5; Protein arginine N methyltransferase 5; Protein arginine N methyltransferase 5 N terminally processed; Protein arginine N-methyltransferase 5; S. POMBE; S. POMBE HOMOLOG OF; SKB1; SHK1 KINASE BINDING PROTEIN 1; Shk1 kinase binding protein 1 homolog; Shk1 kinase-binding protein 1 homolog; Shk1 kinase/binding protein 1; S. pombe; homolog of; SKB 1; SKB1; SKB1 homolog; SKB1: SKB1 homolog (S. pombe); SKB1Hs
Target Background
This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification