-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRMT8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human PRMT8 (NP_062828.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRMT8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human PRMT8 (NP_062828.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13375A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRMT8 |
| Target Synonyms | HRMT1L3; HRMT1L4; T8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-380 of human PRMT8 (NP_062828.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKG | Uniprot ID | Q9NR22 |
Uniprot Id
Q9NR22
Target Species
Human
Target Name
PRMT8
Target Full Name
Protein arginine N-methyltransferase 8
Target Function
S-adenosyl-L-methionine-dependent and membrane-associated arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA) in proteins such as NIFK, myelin basic protein, histone H4, H2A and H2A/H2B dimer. Able to mono- and dimethylate EWS protein; however its precise role toward EWS remains unclear as it still interacts with fully methylated EWS.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family, PRMT8 subfamily
Target Tissue Specificity
Brain-specific.
Target Synonyms
ANM8_HUMAN; Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4 ; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HMT1 hnRNP methyltransferase like 3; HMT1 hnRNP methyltransferase like 4; HRMT1 L3; HRMT1 L4; HRMT1L 3; HRMT1L 4; HRMT1L3; HRMT1L4; prmt8; Protein arginine N methyltransferase 4; Protein arginine N methyltransferase 8; Protein arginine N-methyltransferase 8
Target Background
Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).
Notification