-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRRX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-253 of human PRRX2 (NP_057391.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRRX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-253 of human PRRX2 (NP_057391.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07514A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRRX2 |
| Target Synonyms | PMX2; PRX2; PRRX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Mouse brain, Mouse skin, Mouse spleen, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-253 of human PRRX2 (NP_057391.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN | Uniprot ID | Q99811 |
Uniprot Id
Q99811
Target Species
Human
Target Name
PRRX2
Target Full Name
Paired mesoderm homeobox protein 2
Target Function
May play a role in the scarless healing of cutaneous wounds during the first two trimesters of development.
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Tissue Specificity
In fetal skin, highest expression found in cells of mesodermal origin within the dermal papilla of the developing hair shaft. Not detected in epidermis or dermis. In adult skin, weakly expressed within the basal layers of the epidermis. Not expressed in d
Target Synonyms
Paired mesoderm homeobox protein 2; Paired related homeobox protein 2 ; paired-like homeobox gene 2; paired-like homeodomain protein PRX2; Paired-related homeobox protein 2; PMX2 ; Predicted NUP98/PRRX2 fusion protein; Prrx2; PRRX2_HUMAN; PRX 2; PRX-2; PRX2
Target Background
The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation.
Notification