Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRSS21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-220 of human PRSS21 (NP_006790.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRSS21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-220 of human PRSS21 (NP_006790.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04639A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRSS21 |
| Target Synonyms | ESP1; ESP-1; TEST1; TESTISIN; PRSS21 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 150-220 of human PRSS21 (NP_006790.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD | Uniprot ID | Q9Y6M0 |
Uniprot Id
Q9Y6M0
Target Species
Human
Target Name
PRSS21
Target Full Name
Testisin
Target Function
Could regulate proteolytic events associated with testicular germ cell maturation.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes.
Target Research Area
Cancer
Target Synonyms
Eosinophil serine protease 1; ESP-1; ESP1 ; Prss21; Serine protease 21; TEST_HUMAN; TEST1; Testisin
Target Background
This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. The encoded protein is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The encoded protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and may be involved in progression of testicular tumors of germ cell origin. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
