-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTPRK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-750 of human PTPRK (NP_001129120.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTPRK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-750 of human PTPRK (NP_001129120.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05463A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTPRK |
| Target Synonyms | R-PTP-kappa; PTPRK | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-750 of human PTPRK (NP_001129120.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGVDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDR | Uniprot ID | Q15262 |
Uniprot Id
Q15262
Target Species
Human
Target Name
PTPRK
Target Full Name
Receptor-type tyrosine-protein phosphatase kappa
Target Function
Regulation of processes involving cell contact and adhesion such as growth control, tumor invasion, and metastasis. Negative regulator of EGFR signaling pathway. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTPRK/PTP-kappa.
Target Subcellular Location
Cell junction, adherens junction. Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Protein-tyrosine phosphatase family, Receptor class 2B subfamily
Target Tissue Specificity
High levels in lung, brain and colon; less in liver, pancreas, stomach, kidney, placenta and mammary carcinoma.
Target Synonyms
dJ480J14.2.1; DKFZp686C2268; DKFZp779N1045; OTTHUMP00000017180; OTTHUMP00000017181; OTTHUMP00000017182; OTTHUMP00000017187; OTTHUMP00000040306; Protein tyrosine phosphatase kappa; Protein tyrosine phosphatase kappa precursor; Protein tyrosine phosphatase receptor type K; Protein tyrosine phosphatase receptor type kappa; Protein-tyrosine phosphatase kappa; PTPK; PTPkappa; Ptprk; PTPRK_HUMAN; R PTP kappa; R-PTP-kappa; Receptor type tyrosine protein phosphatase kappa; Receptor-type tyrosine-protein phosphatase kappa
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP mu (MAM) domain, an Ig-like domain and four fibronectin type III-like repeats. This PTP was shown to mediate homophilic intercellular interaction, possibly through the interaction with beta- and gamma-catenin at adherens junctions. Expression of this gene was found to be stimulated by TGF-beta 1, which may be important for the inhibition of keratinocyte proliferation.
Notification