-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB3A (NP_002857.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RAB3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB3A (NP_002857.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08623A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB3A |
| Target Synonyms | RAB3A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB3A (NP_002857.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTG | Uniprot ID | P20336 |
Uniprot Id
P20336
Target Species
Human
Target Name
RAB3A
Target Full Name
Ras-related protein Rab-3A
Target Function
Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane. Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane. Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed. Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells. Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9. Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1. Plays also a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT. Interacts with MADD (via uDENN domain); the GTP-bound form is preferred for interaction.
Target Subcellular Location
Cytoplasm, cytosol. Lysosome. Cytoplasmic vesicle, secretory vesicle. Cell projection, axon. Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rab family
Target Tissue Specificity
Specifically expressed in brain.
Target Synonyms
Rab 3A; RAB 3A member RAS oncogene family; Rab3a; RAB3A member RAS oncogene family; RAB3A_HUMAN; RAS associated protein RAB 3A; RAS associated protein RAB3A; Ras related protein Rab 3A; Ras related protein Rab3A; Ras-related protein Rab-3A
Target Background
Enables GTPase activity and myosin V binding activity. Involved in several processes, including acrosomal vesicle exocytosis; lysosome localization; and plasma membrane repair. Located in perinuclear region of cytoplasm.
Notification