-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human RAC3 (NP_005043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human RAC3 (NP_005043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02465A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAC3 |
| Target Synonyms | RAC3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HL-60, Human placenta, Mouse brain, Mouse lung, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human RAC3 (NP_005043.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF | Uniprot ID | P60763 |
Uniprot Id
P60763
Target Species
Human
Target Name
RAC3
Target Full Name
Ras-related C3 botulinum toxin substrate 3
Target Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Target Subcellular Location
Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Cytoplasm, perinuclear region. Cell membrane. Cytoplasm, cytoskeleton. Note=Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery.
Target Protein Families
Small GTPase superfamily, Rho family
Target Tissue Specificity
Highest levels in brain, also detected in heart, placenta and pancreas.
Target Research Area
Signal Transduction
Target Synonyms
OTTMUSP00000004488; p21 Rac3; p21-Rac3; Rac1B; RAC3; RAC3_HUMAN; RAS related C3 botulinum substrate 3; Ras related C3 botulinum toxin substrate 3 (rho family small GTP binding protein Rac3) ; Ras related C3 botulinum toxin substrate 3 (rho family; small GTP binding protein Rac3); Ras-related C3 botulinum toxin substrate 3; Rho family small GTP binding protein Rac3; RP23-84C12.18
Target Background
The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Alternative splicing results in multiple transcript variants.
Notification