-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAD54L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 648-747 of human RAD54L (Q92698) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAD54L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 648-747 of human RAD54L (Q92698) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09082A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD54L |
| Target Synonyms | HR54; hHR54; RAD54A; hRAD54; RAD54L | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse testis, Mouse thymus, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 648-747 of human RAD54L (Q92698). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR | Uniprot ID | Q92698 |
Uniprot Id
Q92698
Target Species
Human
Target Name
RAD54L
Target Full Name
DNA repair and recombination protein RAD54-like
Target Function
Plays an essential role in homologous recombination (HR) which is a major pathway for repairing DNA double-strand breaks (DSBs), single-stranded DNA (ssDNA) gaps, and stalled or collapsed replication forks. Acts as a molecular motor during the homology search and guides RAD51 ssDNA along a donor dsDNA thereby changing the homology search from the diffusion-based mechanism to a motor-guided mechanism. Plays also an essential role in RAD51-mediated synaptic complex formation which consists of three strands encased in a protein filament formed once homology is recognized. Once DNA strand exchange occured, dissociates RAD51 from nucleoprotein filaments formed on dsDNA.
Target Subcellular Location
Nucleus.
Target Protein Families
SNF2/RAD54 helicase family
Target Synonyms
DNA repair and recombination protein RAD54 like ; DNA repair and recombination protein RAD54-like; hHR 54; hHR54; HR 54; HR54; hRAD 54; hRAD54; RAD 54A; RAD 54L; RAD54 (S. cerevisiae) like ; RAD54 homolog; RAD54 like (S. cerevisiae); RAD54 like; RAD54 like protein; RAD54_HUMAN; RAD54A; RAD54L
Target Background
The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.
Notification