Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RANBP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RANBP6 (NP_036548.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RANBP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RANBP6 (NP_036548.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05612A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RANBP6 |
| Target Synonyms | RANBP6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RANBP6 (NP_036548.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYENIPGLCKTTFLLDAVRNRRAGYEVRQMA | Uniprot ID | O60518 |
Uniprot Id
O60518
Target Species
Human
Target Name
RANBP6
Target Full Name
Ran-binding protein 6
Target Function
May function in nuclear protein import as nuclear transport receptor.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Importin beta family
Target Synonyms
RANBP6; Ran-binding protein 6; RanBP6
Target Background
Predicted to enable nuclear import signal receptor activity and nuclear localization sequence binding activity. Predicted to be involved in protein import into nucleus. Predicted to be active in cytoplasm and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
