-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RanBP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-605 of human RanBP9 (NP_005484.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RanBP9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-605 of human RanBP9 (NP_005484.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02165A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RANBP9 |
| Target Synonyms | BPM-L; BPM90; RANBPM; RanBP7; RanBP9 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, B cells, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-605 of human RanBP9 (NP_005484.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQL | Uniprot ID | Q96S59 |
Uniprot Id
Q96S59
Target Species
Human
Target Name
RANBP9
Target Full Name
Ran-binding protein 9
Target Function
May act as scaffolding protein, and as adapter protein to couple membrane receptors to intracellular signaling pathways (Probable). Acts as a mediator of cell spreading and actin cytoskeleton rearrangement. Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. May be involved in signaling of ITGB2/LFA-1 and other integrins. Enhances HGF-MET signaling by recruiting Sos and activating the Ras pathway. Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but not affect estrogen-induced transactivation. Stabilizes TP73 isoform Alpha, probably by inhibiting its ubiquitination, and increases its proapoptotic activity. Inhibits the kinase activity of DYRK1A and DYRK1B. Inhibits FMR1 binding to RNA.
Target Subcellular Location
Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein.
Target Protein Families
RANBP9/10 family
Target Tissue Specificity
Ubiquitously expressed, with highest levels in testes, placenta, heart, and muscle, and lowest levels in lung. Within the brain, expressed predominantly by neurons in the gray matter of cortex, the granular layer of cerebellum and the Purkinje cells.
Target Synonyms
B cell antigen receptor Ig beta associated protein 1; BPM 90; BPM L; BPM-L; BPM90; BPML; IBAP 1 ; Imp 9; Importin 9; Novel centrosomal protein RanBPM; RAN binding protein 9; Ran binding protein centrosomal; Ran Binding Protein in the Microtubule organizing center; Ran binding protein M; Ran BP9; Ran-binding protein 9; Ran-binding protein M; RANB9_HUMAN; RanBP 7; RANBP 9; RanBP7; RanBP9; RanBPM
Target Background
This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.
Notification