Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAPGEF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAPGEF6 (NP_001157858) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAPGEF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAPGEF6 (NP_001157858) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03226A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAPGEF6 |
| Target Synonyms | RAGEF2; PDZGEF2; KIA001LB; PDZ-GEF2; RA-GEF-2; RAPGEF6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAPGEF6 (NP_001157858). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI | Uniprot ID | Q8TEU7 |
Uniprot Id
Q8TEU7
Target Species
Human
Target Name
RAPGEF6
Target Full Name
Rap guanine nucleotide exchange factor 6
Target Function
Guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. Does not interact with cAMP.
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Upon binding to M-Ras, it translocates to the plasma membrane.
Target Tissue Specificity
Isoform 3 has highest expression levels in the brain, heart, liver, lung and placenta and is barely detectable in skeletal muscle, kidney and pancreas.
Target Synonyms
DKFZp667N084; DKFZp686I15116 ; KIA001LB; PDZ domain containing guanine nucleotide exchange factor (GEF) 2; PDZ domain containing guanine nucleotide exchange factor 2; PDZ domain containing guanine nucleotide exchange factor I; PDZ domain-containing guanine nucleotide exchange factor 2; PDZ GEF 2; PDZ GEF2; PDZ-GEF2; PDZGEF 2; PDZGEF2; RA GEF 2; RA GEF2; RA-GEF-2; RAGEF 2; Rap guanine nucleotide exchange factor (GEF) 6 ; Rap guanine nucleotide exchange factor 2; Rap guanine nucleotide exchange factor 6; RAPGEF6; RPGF6_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
