-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RARG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RARG (NP_000957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RARG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RARG (NP_000957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07865A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RARG |
| Target Synonyms | RARC; NR1B3; RARgamma; [KD Validated] RARG | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, SK-BR-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RARG (NP_000957.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS | Uniprot ID | P13631 |
Uniprot Id
P13631
Target Species
Human
Target Name
RARG
Target Full Name
Retinoic acid receptor gamma
Target Function
Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence of ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. Required for limb bud development. In concert with RARA or RARB, required for skeletal growth, matrix homeostasis and growth plate function.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Nuclear hormone receptor family, NR1 subfamily
Target Tissue Specificity
Expressed in aortic endothelial cells (at protein level).
Target Synonyms
NR1B3; Nuclear receptor subfamily 1 group B member 3; RAR gamma; RAR gamma isoform 2; RAR gamma2; RAR-gamma; RARC; Rarg; RARG_HUMAN; retinoic acid nuclear receptor gamma variant 1; retinoic acid nuclear receptor gamma variant 2; Retinoic acid receptor gamma
Target Background
This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification