-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RASD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 132-281 of human RASD1 (NP_057168.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RASD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 132-281 of human RASD1 (NP_057168.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10093A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RASD1 |
| Target Synonyms | AGS1; DEXRAS1; MGC:26290; RASD1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, A-549, LO2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 132-281 of human RASD1 (NP_057168.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVIS | Uniprot ID | Q9Y272 |
Uniprot Id
Q9Y272
Target Species
Human
Target Name
RASD1
Target Full Name
Dexamethasone-induced Ras-related protein 1
Target Function
Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, perinuclear region. Nucleus.
Target Protein Families
Small GTPase superfamily, RasD family
Target Tissue Specificity
Expressed in a variety of tissues including heart, cardiovascular tissues, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, gastrointestinal and reproductive tissues.
Target Synonyms
Activator of G protein signaling 1; Activator of G protein signaling; Activator of G-protein signaling 1; AGS 1; AGS1; Dexamethasone induced ras related protein 1; Dexamethasone-induced ras protein 1; Dexamethasone-induced Ras-related protein 1; Dexras 1; MGC:26290; RAS dexamethasone induced 1; Ras protein; Dexamethasone-induced; 1; Ras related protein; RASD 1; Rasd1; RASD1_HUMAN
Target Background
This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification