-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBCK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-192 of human RBCK1 (NP_112506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RBCK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-192 of human RBCK1 (NP_112506.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07455A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBCK1 |
| Target Synonyms | XAP3; XAP4; HOIL1; PBMEI; PGBM1; RBCK2; RNF54; HOIL-1; ZRANB4; C20orf18; UBCE7IP3; RBCK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-192 of human RBCK1 (NP_112506.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPGVPQEPGRGQPDAVPEP | Uniprot ID | Q9BYM8 |
Uniprot Id
Q9BYM8
Target Species
Human
Target Name
RBCK1
Target Full Name
RanBP-type and C3HC4-type zinc finger-containing protein 1
Target Function
E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination. Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteasome. Component of the LUBAC complex which conjugates linear ('Met-1'-linked) polyubiquitin chains to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis. Binds polyubiquitin of different linkage types.
Target Involvement
Polyglucosan body myopathy 1 with or without immunodeficiency (PGBM1)
Target Synonyms
C20orf18; Chromosome 20 open reading frame 18; HBV associated factor 4 ; HBV-associated factor 4; Heme-oxidized IRP2 ubiquitin ligase 1; Hepatitis B virus X associated protein 4; Hepatitis B virus X-associated protein 4; HOIL 1L; HOIL-1; HOIL-1L; HOIL1; HOIL1L; RanBP type and C3HC4 type zinc finger containing 1; RanBP-type and C3HC4-type zinc finger-containing protein 1; RBCC protein interacting with PKC1; Rbck1; RBCK2; RING finger protein 54; RNF54 ; UB7I3_HUMAN; UBCE7IP3 ; Ubiquitin conjugating enzyme 7 interacting protein 3; Ubiquitin-conjugating enzyme 7-interacting protein 3; XAP3; XAP4 ; ZRANB4
Target Background
Enables several functions, including identical protein binding activity; protein sequestering activity; and ubiquitin binding activity. Involved in several processes, including T cell receptor signaling pathway; cellular protein metabolic process; and regulation of DNA-binding transcription factor activity. Part of LUBAC complex. Implicated in glycogen storage disease.
Notification