-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBFOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RBFOX1 (NP_665900.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RBFOX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RBFOX1 (NP_665900.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10975A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBFOX1 |
| Target Synonyms | 2BP1; FOX1; A2BP1; FOX-1; HRNBP1; RBFOX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RBFOX1 (NP_665900.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLASQGVLLHPYGVPMIVPAAPYLPGLIQGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPEHTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENT | Uniprot ID | Q9NWB1 |
Uniprot Id
Q9NWB1
Target Species
Human
Target Name
RBFOX1
Target Full Name
RNA binding protein fox-1 homolog 1
Target Function
RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Predominantly expressed in muscle and brain.
Target Synonyms
2BP1; A2 BP1; A2BP 1; A2BP; A2BP1; Ataxin 2 binding protein 1; Ataxin-2-binding protein 1; Ataxin2 binding protein 1; FOX 1; Fox-1 homolog A; fox-1-like RNA-binding protein 1; Hexaribonucleotide binding protein 1; Hexaribonucleotide-binding protein 1; HRNBP 1; HRNBP1; RBFOX1; RFOX1_HUMAN; RNA binding protein fox-1 homolog 1; RNA binding protein fox-1 homolog 1, C. elegans, homolog of, 1; RNA binding protein, fox-1 homolog (C. elegans) 1
Target Background
The Fox-1 family of RNA-binding proteins is evolutionarily conserved, and regulates tissue-specific alternative splicing in metazoa. Fox-1 recognizes a (U)GCAUG stretch in regulated exons or in flanking introns. The protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the product of the SCA2 gene which causes familial neurodegenerative diseases. Fox-1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification