-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBFOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RBFOX2 (NP_001026865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBFOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RBFOX2 (NP_001026865.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07623A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBFOX2 |
| Target Synonyms | RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3; RBFOX2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human RBFOX2 (NP_001026865.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP | Uniprot ID | O43251 |
Uniprot Id
O43251
Target Species
Human
Target Name
RBFOX2
Target Full Name
RNA binding protein fox-1 homolog 2
Target Function
RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Research Area
Transcription
Target Synonyms
RNBP2; Fox 1 homologue; Fox-1 homolog B; FOX2; FXH; Hexaribonucleotide-binding protein 2; HNRBP2; RBFOX2; Repressor of tamoxifen transcriptional activity; RFOX2_HUMAN; RNA binding motif protein 9; RNA binding protein 9; RNA binding protein fox-1 homolog 2; RNA-binding motif protein 9; RNA-binding protein 9; RTA
Target Background
This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification