Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP7 (NP_443192.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RBP7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP7 (NP_443192.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10031A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBP7 |
| Target Synonyms | CRBP4; CRABP4; CRBPIV; RBP7 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP7 (NP_443192.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA | Uniprot ID | Q96R05 |
Uniprot Id
Q96R05
Target Species
Human
Target Name
RBP7
Target Full Name
Retinoid-binding protein 7
Target Function
Intracellular transport of retinol.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Expressed primarily in kidney, heart and transverse colon. Detected in adult lymph node, appendix, ascending colon, and in fetal heart and spleen.
Target Synonyms
Cellular retinoic acid binding protein 4; Cellular retinoic acid-binding protein 4; Cellular retinoic acid-binding protein IV; CRABP IV; CRABP-IV; CRABP4; CRBP4; CRBPIV; Putative cellular retinol-binding protein CRBP IV; Rbp7; RET7_HUMAN; Retinoid binding protein 7; Retinoid-binding protein 7; Retinol binding protein 7, cellular
Target Background
The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
