-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RDM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-284 of human RDM1 (NP_663629.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RDM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-284 of human RDM1 (NP_663629.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02823A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RDM1 |
| Target Synonyms | RAD52B; RDM1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 125-284 of human RDM1 (NP_663629.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD | Uniprot ID | Q8NG50 |
Uniprot Id
Q8NG50
Target Species
Human
Target Name
RDM1
Target Full Name
RAD52 motif-containing protein 1
Target Function
May confer resistance to the antitumor agent cisplatin. Binds to DNA and RNA.
Target Subcellular Location
Nucleus. Cytoplasm. Nucleus, nucleolus. Note=Isoform 3 and isoform 10 are predominantly nuclear and nucleolar. After treatment with proteasomal inhibitors and mild heat-shock stress, isoform 1, isoform 3, isoform 5, isoform 7, isoform 8 and isoform 10 are relocalized to the nucleolus as dot-like or irregular subnuclear structures. Isoform 1 colocalized with nuclear promyelocytic leukemia (PML) and Cajal bodies (CB); this association with nuclear bodies is enhanced in response to proteotoxic stress. Isoform 3, but not isoform 1 and isoform 5, is relocalized in nucleolar caps during transcriptional arrest.; [Isoform 1]: Cytoplasm. Nucleus, PML body. Nucleus, Cajal body. Note=Isoform 1 is predominantly cytoplasmic. Isoform 1 colocalized with nuclear promyelocytic leukemia (PML) and Cajal bodies (CB); this association with nuclear bodies is enhanced in response to proteotoxic stress.
Target Tissue Specificity
Expressed in testis.
Target Synonyms
MGC33977; RAD52 homolog B; RAD52 motif 1; RAD52 motif containing 1; RAD52 motif-containing protein 1; RAD52B; RDM1; RDM1_HUMAN
Target Background
This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization. Alternatively spliced transcript variants encoding different isoforms have been reported.
Notification