-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RELT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-162 of human RELT (NP_116260.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RELT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-162 of human RELT (NP_116260.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04981A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RELT |
| Target Synonyms | AI3C; TRLT; TNFRSF19L; RELT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, LO2, Mouse brain, Mouse thymus, Raji, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-162 of human RELT (NP_116260.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQ | Uniprot ID | Q969Z4 |
Uniprot Id
Q969Z4
Target Species
Human
Target Name
RELT
Target Full Name
Tumor necrosis factor receptor superfamily member 19L
Target Function
May play a role in apoptosis. Induces activation of MAPK14/p38 and MAPK8/JNK MAPK cascades, when overexpressed. Involved in dental enamel formation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Cytoplasm, perinuclear region.
Target Protein Families
RELT family
Target Tissue Specificity
Spleen, lymph node, brain, breast and peripheral blood leukocytes (at protein level). Expressed highly in bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in kidney and pancreas.
Target Research Area
Signal Transduction
Target Synonyms
Receptor expressed in lymphoid tissues; Relt; TNFRSF19L; TR19L_HUMAN; Tumor necrosis factor receptor superfamily member 19L
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.
Notification