-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RFX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-430 of human RFX3 (NP_602304.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RFX3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-430 of human RFX3 (NP_602304.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05146A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RFX3 |
| Target Synonyms | RFX3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 280-430 of human RFX3 (NP_602304.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPTDGTTITESSNLSEIESRLPKAKLITLCKHESILKWMCN | Uniprot ID | P48380 |
Uniprot Id
P48380
Target Species
Human
Target Name
RFX3
Target Full Name
Transcription factor RFX3
Target Function
Transcription factor required for ciliogenesis and islet cell differentiation during endocrine pancreas development. Essential for the differentiation of nodal monocilia and left-right asymmetry specification during embryogenesis. Required for the biogenesis of motile cilia by governing growth and beating efficiency of motile cells. Also required for ciliated ependymal cell differentiation. Regulates the expression of genes involved in ciliary assembly (DYNC2LI1, FOXJ1 and BBS4) and genes involved in ciliary motility (DNAH11, DNAH9 and DNAH5). Together with RFX6, participates in the differentiation of 4 of the 5 islet cell types during endocrine pancreas development, with the exception of pancreatic PP (polypeptide-producing) cells. Regulates transcription by forming a heterodimer with another RFX protein and binding to the X-box in the promoter of target genes. Represses transcription of MAP1A in non-neuronal cells but not in neuronal cells.
Target Subcellular Location
Nucleus.
Target Protein Families
RFX family
Target Synonyms
bA32F11.1; DNA binding protein RFX3; Regulatory factor X 3; Regulatory factor X; 3 (influences HLA class II expression); RFX3; RFX3_HUMAN; Transcription factor RFX3
Target Background
This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. Multiple transcript variants encoding different isoforms have been described for this gene.
Notification