-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RIOX2/MINA53 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human RIOX2/MINA53 (Q8IUF8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RIOX2/MINA53 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human RIOX2/MINA53 (Q8IUF8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14277A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RIOX2/MINA53 |
| Target Synonyms | ROX; MDIG; MINA; NO52; JMJD10; MINA53; RIOX2/MINA53 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human RIOX2/MINA53 (Q8IUF8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSTPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKE | Uniprot ID | Q8IUF8 |
Uniprot Id
Q8IUF8
Target Species
Human
Target Name
RIOX2
Target Full Name
Ribosomal oxygenase 2
Target Function
Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Is involved in the demethylation of trimethylated 'Lys-9' on histone H3 (H3K9me3), leading to an increase in ribosomal RNA expression. Also catalyzes the hydroxylation of 60S ribosomal protein L27a on 'His-39'. May play an important role in cell growth and survival. May be involved in ribosome biogenesis, most likely during the assembly process of pre-ribosomal particles.
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Protein Families
ROX family, MINA53 subfamily
Target Tissue Specificity
Expressed in liver, skeletal muscle, heart, pancreas, and placenta. Not detected in brain, lung or kidney. Expressed in several lung cancer tissues, but is barely detected in the adjacent non-cancerous tissues. Also highly expressed in several esophageal
Target Synonyms
60S ribosomal protein L27a histidine hydroxylase; Bifunctional lysine specific demethylase and histidyl hydroxylase MINA; FLJ14393; Histone lysine demethylase MINA; MDIG; MINA; MINA_HUMAN; Mineral dust-induced gene protein; Myc induced nuclear antigen 53 kDa; MYC induced nuclear antigen; MYC-induced nuclear antigen; NO52; Nucleolar protein 52; Ribosomal oxygenase MINA; ROX
Target Background
MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).
Notification