Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNASE2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-161 of human RNASE2 (NP_002925.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RNASE2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-161 of human RNASE2 (NP_002925.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08894A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNASE2 |
| Target Synonyms | EDN; RAF3; RNS2; RNASE2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, K-562, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-161 of human RNASE2 (NP_002925.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII | Uniprot ID | P10153 |
Uniprot Id
P10153
Target Species
Human
Target Name
RNASE2
Target Full Name
Non-secretory ribonuclease
Target Function
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chemotactic for dendritic cells. Possesses a wide variety of biological activities.
Target Subcellular Location
Lysosome. Cytoplasmic granule. Note=Matrix of eosinophil's large specific granule.
Target Protein Families
Pancreatic ribonuclease family
Target Tissue Specificity
Liver, lung, spleen, leukocytes and body fluids.
Target Research Area
Immunology
Target Synonyms
RNASE2; EDN; RNS2; Non-secretory ribonuclease; EC 4.6.1.18; Eosinophil-derived neurotoxin; RNase UpI-2; Ribonuclease 2; RNase 2; Ribonuclease US
Target Background
The protein encoded by this gene is a non-secretory ribonuclease that belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein antimicrobial activity against viruses.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
