-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human RNF14 (Q9UBS8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF14 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human RNF14 (Q9UBS8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13316A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF14 |
| Target Synonyms | ARA54; HFB30; TRIAD2; HRIHFB2038; RNF14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Jurkat, K-562, Mouse placenta, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human RNF14 (Q9UBS8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKN | Uniprot ID | Q9UBS8 |
Uniprot Id
Q9UBS8
Target Species
Human
Target Name
RNF14
Target Full Name
E3 ubiquitin-protein ligase RNF14
Target Function
Might act as an E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates, which could be nuclear proteins. Could play a role as a coactivator for androgen- and, to a lesser extent, progesterone-dependent transcription.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
RBR family, RNF14 subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
Androgen receptor associated protein 54; Androgen receptor-associated protein 54; ARA 54; ARA54; E3 ubiquitin protein ligase RNF14; E3 ubiquitin-protein ligase RNF14; FLJ26004; HFB 30; HFB30; HRIHFB2038; RING finger protein 14; RNF 14; Rnf14; RNF14_HUMAN; TRIAD 2; TRIAD2; Triad2 protein
Target Background
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Notification