-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RNF5 (NP_008844.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RNF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RNF5 (NP_008844.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12075A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF5 |
| Target Synonyms | RMA1; RING5; RNF5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, HepG2, Jurkat, MCF7, Mouse liver, Mouse spleen, NCI-H460, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RNF5 (NP_008844.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF | Uniprot ID | Q99942 |
Uniprot Id
Q99942
Target Species
Human
Target Name
RNF5
Target Full Name
E3 ubiquitin-protein ligase RNF5
Target Function
Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurs in mitochondria after viral transfection and regulates antiviral responses.
Target Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane. Note=Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.
Target Tissue Specificity
Widely expressed.
Target Synonyms
RNF5; G16; NG2; RMA1; E3 ubiquitin-protein ligase RNF5; Protein G16; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5; Ram1 homolog; HsRma1
Target Background
The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.
Notification