-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ROCK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1289-1388 of human ROCK2 (O75116) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ROCK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1289-1388 of human ROCK2 (O75116) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16885A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ROCK2 |
| Target Synonyms | ROCK-II; ROCK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Mouse lung, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1289-1388 of human ROCK2 (O75116). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS | Uniprot ID | O75116 |
Uniprot Id
O75116
Target Species
Human
Target Name
ROCK2
Target Full Name
Rho-associated protein kinase 2
Target Function
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca(2+) sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family
Target Tissue Specificity
Expressed in the brain (at protein level).
Target Synonyms
coiled-coil-containing protein kinase 2; KIAA0619; p164 ROCK 2; p164 ROCK-2; Rho associated coiled coil containing protein kinase 2; Rho associated protein kinase 2; Rho associated; coiled coil containing protein kinase II; Rho kinase 2; Rho-associated; Rho-associated protein kinase 2; ROCK 2; Rock II; Rock2; ROCK2_HUMAN; Rock2m; ROK alpha; ROKalpha
Target Background
The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho.
Notification