Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL18A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-176 of human RPL18A (NP_000971.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPL18A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-176 of human RPL18A (NP_000971.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04155A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL18A |
| Target Synonyms | L18A; eL20; RPL18A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse liver, Mouse testis, Rat spleen, Rat testis, Rat thymus, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-176 of human RPL18A (NP_000971.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF | Uniprot ID | Q02543 |
Uniprot Id
Q02543
Target Species
Human
Target Name
RPL18A
Target Full Name
Large ribosomal subunit protein eL20
Target Synonyms
L18A; eL20; RPL18A
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18AE family of ribosomal proteins that is a component of the 60S subunit. The encoded protein may play a role in viral replication by interacting with the hepatitis C virus internal ribosome entry site (IRES). This gene is co-transcribed with the U68 snoRNA, located within the third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
