Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-157 of human RPL24 (NP_000977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RPL24 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-157 of human RPL24 (NP_000977.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11928A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL24 |
| Target Synonyms | L24; eL24; HEL-S-310; RPL24 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse testis, Rat testis, RAW 264.7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 38-157 of human RPL24 (NP_000977.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR | Uniprot ID | P83731 |
Uniprot Id
P83731
Target Species
Human
Target Name
RPL24
Target Full Name
Large ribosomal subunit protein eL24
Target Synonyms
60S ribosomal protein L24; 60S ribosomal protein L30; L24; Ribosomal protein L24; Ribosomal protein L30; RL24_HUMAN; RPL 24; RPL24
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24E family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as ribosomal protein L30 because the encoded protein shares amino acid identity with the L30 ribosomal proteins from S. cerevisiae; however, its official name is ribosomal protein L24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
