-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RPL5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00539A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL5 |
| Target Synonyms | L5; uL18; MSTP030; PPP1R135; RPL5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HepG2, HT-29, Mouse brain, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY | Uniprot ID | P46777 |
Uniprot Id
P46777
Target Species
Human
Target Name
RPL5
Target Full Name
Large ribosomal subunit protein uL18
Target Function
Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. As part of the 5S RNP/5S ribonucleoprotein particle it is an essential component of the LSU, required for its formation and the maturation of rRNAs. It also couples ribosome biogenesis to p53/TP53 activation. As part of the 5S RNP it accumulates in the nucleoplasm and inhibits MDM2, when ribosome biogenesis is perturbed, mediating the stabilization and the activation of TP53.
Target Involvement
Diamond-Blackfan anemia 6 (DBA6)
Target Subcellular Location
Cytoplasm. Nucleus, nucleolus.
Target Protein Families
Universal ribosomal protein uL18 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
60S ribosomal protein L5; DBA6; L5; MSTP030; PPP1R135; protein phosphatase 1, regulatory subunit 135; Ribosomal protein L5; RL5; RL5_HUMAN; RP L5; RPL 5; RPL5; U21 RNA; U21RNA
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L18P family of ribosomal proteins and component of the 60S subunit. The encoded protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The encoded protein may also function to inhibit tumorigenesis through the activation of downstream tumor suppressors and the downregulation of oncoprotein expression. Mutations in this gene have been identified in patients with Diamond-Blackfan Anemia (DBA). This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome.
Notification