-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RUFY3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RUFY3 (NP_055776.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RUFY3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RUFY3 (NP_055776.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03319A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RUFY3 |
| Target Synonyms | RIPX; SINGAR1; ZFYVE30; RUFY3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RUFY3 (NP_055776.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM | Uniprot ID | Q7L099 |
Uniprot Id
Q7L099
Target Species
Human
Target Name
RUFY3
Target Full Name
Protein RUFY3
Target Function
Plays a role in the generation of neuronal polarity formation and axon growth. Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes. Plays a role in the formation of F-actin-enriched protrusive structures at the cell periphery. Plays a role in cytoskeletal organization by regulating the subcellular localization of FSCN1 and DBN1 at axonal growth cones. Promotes gastric cancer cell migration and invasion in a PAK1-dependent manner.
Target Subcellular Location
Cytoplasm. Endomembrane system. Cell projection, invadopodium. Perikaryon. Cell projection. Cell projection, growth cone. Cell projection, filopodium. Cell projection, lamellipodium.
Target Tissue Specificity
Overexpressed in gastric cancer cells and tissues (at protein level).
Target Synonyms
Protein RUFY3; rap2 interacting protein x; Rap2 interacting protein x isoform 2; Rap2-interacting protein x; RIPx; Rpipx; Rufy3; RUFY3_HUMAN; RUN and FYVE domain containing 3; Singar; Singar1; Single axon regulated protein; single axon related 1; Single axon-regulated protein
Target Background
This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants.
Notification