-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A2 (NP_005969.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against S100A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A2 (NP_005969.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11809A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A2 |
| Target Synonyms | CAN19; S100L; S100A2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, MCF7, Mouse uterus, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A2 (NP_005969.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP | Uniprot ID | P29034 |
Uniprot Id
P29034
Target Species
Human
Target Name
S100A2
Target Full Name
Protein S100-A2
Target Function
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.
Target Protein Families
S-100 family
Target Tissue Specificity
A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
Target Synonyms
CAN19; MGC111539; Protein S 100L; Protein S-100L; Protein S100 A2; Protein S100-A2; Protein S100L; S100 A2; S100 calcium binding protein A2; S100 calcium-binding protein A2; S100A2; S100L; S10A2_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer.
Notification