-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100P was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against S100P was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14395A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100P |
| Target Synonyms | MIG9; S100P | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human S100P (NP_005971.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK | Uniprot ID | P25815 |
Uniprot Id
P25815
Target Species
Human
Target Name
S100P
Target Full Name
Protein S100-P
Target Function
May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).
Target Subcellular Location
Nucleus. Cytoplasm. Cell projection, microvillus membrane. Note=Colocalizes with S100PBP in the nucleus. Colocolizes with EZR in the microvilli in a calcium-dependent manner.
Target Protein Families
S-100 family
Target Tissue Specificity
Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial n
Target Research Area
Cancer
Target Synonyms
MIG9; Migration inducing gene 9; Protein S100-E; Protein S100-P; Protein S100P; S100 calcium binding protein P; S100 calcium-binding protein P; S100 P; S100E; S100P; S100P_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer.
Notification