Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCAMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human SCAMP2 (NP_005688.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCAMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human SCAMP2 (NP_005688.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03968A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCAMP2 |
| Target Synonyms | SCAMP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human SCAMP2 (NP_005688.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKML | Uniprot ID | O15127 |
Uniprot Id
O15127
Target Species
Human
Target Name
SCAMP2
Target Full Name
Secretory carrier-associated membrane protein 2
Target Function
Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Target Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.
Target Protein Families
SCAMP family
Target Tissue Specificity
Widely expressed.
Target Synonyms
SCAMP2; Secretory carrier-associated membrane protein 2; Secretory carrier membrane protein 2
Target Background
This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
