Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Sec61A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Sec61A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14270A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Sec61A |
| Target Synonyms | Sec61 alpha-2; SEC61A2; Sec61A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse lung, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Sec61A (Q9H9S3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA | Uniprot ID | Q9H9S3 |
Uniprot Id
Q9H9S3
Target Species
Human
Target Name
SEC61A2
Target Full Name
Protein transport protein Sec61 subunit alpha isoform 2
Target Function
Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
SecY/SEC61-alpha family
Target Synonyms
SEC61A2; Protein transport protein Sec61 subunit alpha isoform 2; Sec61 alpha-2
Target Background
The protein encoded by this gene has similarity to a mouse protein which suggests a role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. It may also be required for the assembly of membrane and secretory proteins. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
