-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Septin 11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Septin 11 (NP_060713.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Septin 11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Septin 11 (NP_060713.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02142A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Septin 11 |
| Target Synonyms | SEPT11; Septin 11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, NIH/3T3, Rat brain, 293T, Jurkat, Mouse brain, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Septin 11 (NP_060713.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEY | Uniprot ID | Q9NVA2 |
Uniprot Id
Q9NVA2
Target Species
Human
Target Name
SEPT11
Target Full Name
Septin-11
Target Function
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity. During Listeria monocytogenes infection, not required for the bacterial entry process, but restricts its efficacy.
Target Involvement
A chromosomal aberration involving SEPT11 may be a cause of chronic neutrophilic leukemia. Translocation t(4;11)(q21;q23) with KMT2A/MLL1.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell junction, synapse. Cell projection, dendritic spine. Cell projection, axon. Note=Partly colocalizes with stress fibers and microtubules. During bacterial infection, displays a collar shape structure next to actin at the pole of invading bacteria.
Target Protein Families
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
Target Tissue Specificity
Widely expressed, except in leukocytes.
Target Synonyms
SEP11_HUMAN; SEPT 11; Sept11; Septin-11; Septin11
Target Background
SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking (Hanai et al., 2004 [PubMed 15196925]; Nagata et al., 2004 [PubMed 15485874]).
Notification