Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human SERBP1 (NP_001018078.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human SERBP1 (NP_001018078.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERBP1 |
| Target Synonyms | CGI-55; CHD3IP; HABP4L; PAIRBP1; PAI-RBP1; SERBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse lung, Rat liver, Rat lung, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human SERBP1 (NP_001018078.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPD | Uniprot ID | Q8NC51 |
Uniprot Id
Q8NC51
Target Species
Human
Target Name
SERBP1
Target Full Name
SERPINE1 mRNA-binding protein 1
Target Function
May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation.
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, perinuclear region.
Target Tissue Specificity
Expressed at high level in the heart, skeletal muscle and kidney, and at low levels in placenta, liver and brain.
Target Synonyms
CGI 55; CHD3IP; Chromodomain helicase DNA binding protein 3 interacting protein; DKFZp564M2423; FLJ90489; HABP4L; PAI 1 mRNA binding protein; PAI RBP1; PAI-RBP1; PAI1 RNA-binding protein 1; PAIRB_HUMAN; PAIRBP1; Plasminogen activator inhibitor 1 RNA binding protein; Plasminogen activator inhibitor 1 RNA-binding protein; Serbp1; SERPINE1 mRNA binding protein 1; SERPINE1 mRNA-binding protein 1
Target Background
Enables SUMO binding activity; mRNA 3'-UTR binding activity; and ribosome binding activity. Involved in PML body organization. Located in cytosol and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
