Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERINC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-453 of human SERINC1 (NP_065806.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SERINC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-453 of human SERINC1 (NP_065806.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00773A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERINC1 |
| Target Synonyms | TDE2; TMS2; TDE1L; TMS-2; SERINC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-453 of human SERINC1 (NP_065806.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESTLIEDGGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD | Uniprot ID | Q9NRX5 |
Uniprot Id
Q9NRX5
Target Species
Human
Target Name
SERINC1
Target Full Name
Serine incorporator 1
Target Function
Enhances the incorporation of serine into phosphatidylserine and sphingolipids.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
TDE1 family
Target Synonyms
1500011D18Rik; AI315070; AIGP 2; KIAA1253; LRRGT00191; mKIAA1253; SERC1_HUMAN; SERINC1; Serine incorporator 1; TDE1L; TDE2; TMS 2; Tms2; Tumor differentially expressed 1 protein like ; Tumor differentially expressed protein 1-like; Tumor differentially expressed protein 2; UNQ396/PRO732
Target Background
Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in several processes, including phosphatidylserine metabolic process; positive regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity; and positive regulation of serine C-palmitoyltransferase activity. Predicted to be located in endoplasmic reticulum membrane and plasma membrane. Predicted to be active in membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
