Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINB8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 173-242 of human SERPINB8 (NP_001027018.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SERPINB8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 173-242 of human SERPINB8 (NP_001027018.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03387A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINB8 |
| Target Synonyms | PI8; CAP2; PI-8; PSS5; C18orf53; SERPINB8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 173-242 of human SERPINB8 (NP_001027018.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE | Uniprot ID | P50452 |
Uniprot Id
P50452
Target Species
Human
Target Name
SERPINB8
Target Full Name
Serpin B8
Target Function
Has an important role in epithelial desmosome-mediated cell-cell adhesion.
Target Involvement
Peeling skin syndrome 5 (PSS5)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Serpin family, Ov-serpin subfamily
Target Synonyms
CAP 2; CAP-2; CAP2; Cytoplasmic antiproteinase 2; OTTHUMP00000067000; OTTHUMP00000067001; Peptidase inhibitor 8; PI 8; PI-8; PI8; Protease inhibitor 8 (ovalbumin type); Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 8; Serpin B8; Serpin peptidase inhibitor clade B (ovalbumin) member 8; Serpinb8; SPB8_HUMAN
Target Background
The protein encoded by this gene is a member of the ov-serpin family of serine protease inhibitors. The encoded protein is produced by platelets and can bind to and inhibit the function of furin, a serine protease involved in platelet functions. In addition, this protein has been found to enhance the mechanical stability of cell-cell adhesion in the skin, and defects in this gene have been associated with an autosomal-recessive form of exfoliative ichthyosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
