Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SERPINB9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-308 of human SERPINB9 (NP_004146.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SERPINB9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-308 of human SERPINB9 (NP_004146.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09490A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SERPINB9 |
| Target Synonyms | PI9; CAP3; PI-9; CAP-3; SERPINB9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen, Rat spleen, Rat thymus, SKOV3, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-308 of human SERPINB9 (NP_004146.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERD | Uniprot ID | P50453 |
Uniprot Id
P50453
Target Species
Human
Target Name
SERPINB9
Target Full Name
Serpin B9
Target Function
Granzyme B inhibitor.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Serpin family, Ov-serpin subfamily
Target Research Area
Immunology
Target Synonyms
CAP 3; CAP-3; CAP3; Cytoplasmic antiproteinase 3; Peptidase inhibitor 9; PI-9; PI9; Protease inhibitor 9; Protease inhibitor 9 (ovalbumin type); Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 9; Serpin B9; Serpin peptidase inhibitor clade B (ovalbumin) member 9; Serpin peptidase inhibitor clade B member 9; SERPINB9; SPB9_HUMAN
Target Background
This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
