-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SH3BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 392-561 of human SH3BP2 (NP_001116153.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SH3BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 392-561 of human SH3BP2 (NP_001116153.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01351A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SH3BP2 |
| Target Synonyms | 3BP2; CRBM; CRPM; 3BP-2; RES4-23; SH3BP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 392-561 of human SH3BP2 (NP_001116153.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPEAMARPAVLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR | Uniprot ID | P78314 |
Uniprot Id
P78314
Target Species
Human
Target Name
SH3BP2
Target Full Name
SH3 domain-binding protein 2
Target Function
Binds differentially to the SH3 domains of certain proteins of signal transduction pathways. Binds to phosphatidylinositols; linking the hemopoietic tyrosine kinase fes to the cytoplasmic membrane in a phosphorylation dependent mechanism.
Target Involvement
Cherubism (CRBM)
Target Tissue Specificity
Expressed in a variety of tissues including lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
3BP-2; 3BP2; 3BP2_HUMAN; Abl SH3 binding protein 2 ; Cherubism ; CRBM; CRPM; FLJ42079; FLJ54978; RES4-23; SH3 domain binding protein 2; SH3 domain-binding protein 2; Sh3bp2; TNFAIP3 interacting protein 2
Target Background
The protein encoded by this gene has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases , and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification