-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIRT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 299-399 of human SIRT3 (NP_036371.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIRT3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 299-399 of human SIRT3 (NP_036371.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07697A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIRT3 |
| Target Synonyms | SIR2L3; SIRT3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Hep G2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 299-399 of human SIRT3 (NP_036371.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK | Uniprot ID | Q9NTG7 |
Uniprot Id
Q9NTG7
Target Species
Human
Target Name
SIRT3
Target Full Name
NAD-dependent protein deacetylase sirtuin-3, mitochondrial
Target Function
NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5PO. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels. In response to metabolic stress, deacetylates transcription factor FOXO3 and recruits FOXO3 and mitochondrial RNA polymerase POLRMT to mtDNA to promote mtDNA transcription. Acts as a regulator of ceramide metabolism by mediating deacetylation of ceramide synthases CERS1, CERS2 and CERS6, thereby increasing their activity and promoting mitochondrial ceramide accumulation.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Sirtuin family, Class I subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
hSIRT 3; hSIRT3; Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase; NAD dependent deacetylase sirtuin 3 mitochondrial; NAD-dependent protein deacetylase sirtuin-3, mitochondrial; Regulatory protein SIR2 homolog 3; Silent mating type information regulation 2 S.cerevisiae homolog 3; Sir 2 like 3; SIR 2 like protein 3; SIR 3; SIR2 L3; Sir2 like 3; SIR2 like protein 3; SIR2-like protein 3; SIR2L3; SIR3_HUMAN; SIRT 3; SIRT3; Sirtuin 3; Sirtuin silent mating type information regulation 2 homolog 3 (S. cerevisiae); Sirtuin type 3; Sirtuin3
Target Background
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.
Notification