-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SIX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-174 of human SIX2 (NP_058628.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SIX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-174 of human SIX2 (NP_058628.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01119A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SIX2 |
| Target Synonyms | SIX2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Rat skeletal muscle, RD | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-174 of human SIX2 (NP_058628.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKN | Uniprot ID | Q9NPC8 |
Uniprot Id
Q9NPC8
Target Species
Human
Target Name
SIX2
Target Full Name
Homeobox protein SIX2
Target Function
Transcription factor that plays an important role in the development of several organs, including kidney, skull and stomach. During kidney development, maintains cap mesenchyme multipotent nephron progenitor cells in an undifferentiated state by opposing the inductive signals emanating from the ureteric bud and cooperates with WNT9B to promote renewing progenitor cells proliferation. Acts through its interaction with TCF7L2 and OSR1 in a canonical Wnt signaling independent manner preventing transcription of differentiation genes in cap mesenchyme such as WNT4. Also acts independently of OSR1 to activate expression of many cap mesenchyme genes, including itself, GDNF and OSR1. During craniofacial development plays a role in growth and elongation of the cranial base through regulation of chondrocyte differentiation. During stomach organogenesis, controls pyloric sphincter formation and mucosal growth through regulation of a gene network including NKX2-5, BMPR1B, BMP4, SOX9 and GREM1. During branchial arch development, acts to mediate HOXA2 control over the insulin-like growth factor pathway. Also may be involved in limb tendon and ligament development. Plays a role in cell proliferation and migration.
Target Subcellular Location
Nucleus.
Target Protein Families
SIX/Sine oculis homeobox family
Target Tissue Specificity
Strongly expressed in skeletal muscle. Expressed in Wilms' tumor and in the cap mesenchyme of fetal kidney (at protein level).
Target Synonyms
Homeobox protein SIX2; OTTHUMP00000201649; Sine oculis homeobox (Drosophila) homolog 2; Sine oculis homeobox homolog 2 (Drosophila); Sine oculis homeobox homolog 2; SIX homeobox 2; Six2; SIX2_HUMAN
Target Background
This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or eye development.
Notification