-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SKP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SKP2 (Q13309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SKP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SKP2 (Q13309) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16044A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SKP2 |
| Target Synonyms | p45; FBL1; FLB1; FBXL1; SKP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse thymus, Rat thymus | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SKP2 (Q13309). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSL | Uniprot ID | Q13309 |
Uniprot Id
Q13309
Target Species
Human
Target Name
SKP2
Target Full Name
S-phase kinase-associated protein 2
Target Function
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. Degradation of CDKN1B/p27kip also requires CKS1. Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, FOXO1, UBP43, YTHDF2, and probably MYC, TOB1 and TAL1. Degradation of TAL1 also requires STUB1. Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2. Promotes ubiquitination and destruction of CDH1 in a CK1-dependent manner, thereby regulating cell migration.; Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Research Area
Cancer
Target Synonyms
CDK2/Cyclin A associated protein p45; Cyclin A/CDK2 associated protein p45; Cyclin-A/CDK2-associated protein p45; F box protein Skp2; F box/LRR repeat protein 1; F-box protein Skp2; F-box/LRR-repeat protein 1; FBL 1; FBL1; FBXL 1; FBXL1; FLB 1; FLB1; MGC1366; p45; p45skp2; S phase kinase associated protein 2 (p45); S phase kinase associated protein 2; S-phase kinase-associated protein 2; S-phase kinase-associated protein 2 E3 ubiquitin protein ligase; SKP 2; Skp2; SKP2_HUMAN
Target Background
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms.
Notification